Psychicreadingsinnewsmyrnafl.com Whois Record
(Updated 2510 days ago)
|
|
Registration Information
ICANN Registrar : | |
---|---|
Referral URL : | |
Whois Server : | com.whois-servers.net |
Nameservers : | |
Registrar Status : |
Whois Contact Information
Whois Server Version 2.0 Domain names in the .com and .net domains can now be registered with many different competing registrars. Go to http://www.internic.net for detailed information. No match for domain "PSYCHICREADINGSINNEWSMYRNAFL.COM". >>> Last update of whois database: Wed, 05 Jul 2017 21:16:41 GMT |