Ravenhawksmagickalmysticalplaces.com Whois Record
(Updated 3186 days ago)
|
|
Registration Information
ICANN Registrar : | ENOM, INC. |
---|---|
Referral URL : | http://www.enom.com |
Whois Server : | com.whois-servers.net |
Nameservers : | ns1.lunarpages.com ns2.lunarpages.com |
Registrar Status : | clientTransferProhibited https://www.icann.org/epp#clientTransferProhibited |
Registration Dates
Created : | 2007-07-29 |
---|---|
Expires : | 2016-07-29 |
Last Updated : | 2015-07-04 |
Whois Contact Information
Domain Name: RAVENHAWKSMAGICKALMYSTICALPLACES.COM Registry Domain ID: 1116999574_DOMAIN_COM-VRSN Registrar WHOIS Server: whois.enom.com Registrar URL: www.enom.com Updated Date: Creation Date: 2007-07-29T00:56:37.00Z Registrar Registration Expiration Date: 2016-07-29T00:56:37.00Z Registrar: ENOM, INC. Registrar IANA ID: 48 Domain Status: clientTransferProhibited https://www.icann.org/epp#clientTransferProhibited Registry Registrant ID: Registrant Name: DIANA WYNE Registrant Organization: DIANA WYNE Registrant Street: 21145 3RD ST Registrant City: HILLMAN Registrant State/Province: MI Registrant Postal Code: 49746 Registrant Country: US Registrant Phone: +1.2674363713 Registrant Phone Ext: Registrant Fax: NONE Registrant Fax Ext: Registrant Email: RAVENHAWKS@RAVENHAWKS.NET Registry Admin ID: Admin Name: DIANA WYNE Admin Organization: DIANA WYNE Admin Street: 21145 3RD ST Admin City: HILLMAN Admin State/Province: MI Admin Postal Code: 49746 Admin Country: US Admin Phone: +1.2674363713 Admin Phone Ext: Admin Fax: NONE Admin Fax Ext: Admin Email: RAVENHAWKS@RAVENHAWKS.NET Registry Tech ID: Tech Name: DIANA WYNE Tech Organization: DIANA WYNE Tech Street: 21145 3RD ST Tech City: HILLMAN Tech State/Province: MI Tech Postal Code: 49746 Tech Country: US Tech Phone: +1.2674363713 Tech Phone Ext: Tech Fax: NONE Tech Fax Ext: Tech Email: RAVENHAWKS@RAVENHAWKS.NET Name Server: ns1.lunarpages.com Name Server: ns2.lunarpages.com DNSSEC: unSigned Registrar Abuse Contact Email: abuse@enom.com Registrar Abuse Contact Phone: +1.4252982646 URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/ Last update of WHOIS database: The data in this whois database is provided to you for information purposes only, that is, to assist you in obtaining information about or related to a domain name registration record. We make this information available "as is," and do not guarantee its accuracy. By submitting a whois query, you agree that you will use this data only for lawful purposes and that, under no circumstances will you use this data to: (1) enable high volume, automated, electronic processes that stress or load this whois database system providing you this information; or (2) allow, enable, or otherwise support the transmission of mass unsolicited, commercial advertising or solicitations via direct mail, electronic mail, or by telephone. The compilation, repackaging, dissemination or other use of this data is expressly prohibited without prior written consent from us. We reserve the right to modify these terms at any time. By submitting this query, you agree to abide by these terms. Version 6.3 4/3/2002 Get Noticed on the Internet! Increase visibility for this domain name by listing it at www.whoisbusinesslistings.com |