Ravenhawksmagickalmysticalplaces.com Whois Record

ravenhawksmagickalmysticalplaces.com
(Updated 3186 days ago)
Domain : ravenhawksmagickalmysticalplaces.com
Domain Title : Magickal, Ceremonial, Spiritual, Ritual, Witchcraft, Occult and Wiccan Supplies
WRPageWRPage : Complete In-Page SEO Analysis New Feature
Website IP : 67.210.125.155
Hosting Country : United States

Registration Information

ICANN Registrar : ENOM, INC.
Referral URL : http://www.enom.com
Whois Server : com.whois-servers.net
Nameservers : ns1.lunarpages.com
ns2.lunarpages.com
Registrar Status : clientTransferProhibited https://www.icann.org/epp#clientTransferProhibited

Registration Dates

Created : 2007-07-29
Expires : 2016-07-29
Last Updated : 2015-07-04

Whois Contact Information

Domain Name: RAVENHAWKSMAGICKALMYSTICALPLACES.COM
Registry Domain ID: 1116999574_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.enom.com
Registrar URL: www.enom.com
Updated Date:
Creation Date: 2007-07-29T00:56:37.00Z
Registrar Registration Expiration Date: 2016-07-29T00:56:37.00Z
Registrar: ENOM, INC.
Registrar IANA ID: 48
Domain Status: clientTransferProhibited https://www.icann.org/epp#clientTransferProhibited
Registry Registrant ID:
Registrant Name: DIANA WYNE
Registrant Organization: DIANA WYNE
Registrant Street: 21145 3RD ST
Registrant City: HILLMAN
Registrant State/Province: MI
Registrant Postal Code: 49746
Registrant Country: US
Registrant Phone: +1.2674363713
Registrant Phone Ext:
Registrant Fax: NONE
Registrant Fax Ext:
Registrant Email: RAVENHAWKS@RAVENHAWKS.NET
Registry Admin ID:
Admin Name: DIANA WYNE
Admin Organization: DIANA WYNE
Admin Street: 21145 3RD ST
Admin City: HILLMAN
Admin State/Province: MI
Admin Postal Code: 49746
Admin Country: US
Admin Phone: +1.2674363713
Admin Phone Ext:
Admin Fax: NONE
Admin Fax Ext:
Admin Email: RAVENHAWKS@RAVENHAWKS.NET
Registry Tech ID:
Tech Name: DIANA WYNE
Tech Organization: DIANA WYNE
Tech Street: 21145 3RD ST
Tech City: HILLMAN
Tech State/Province: MI
Tech Postal Code: 49746
Tech Country: US
Tech Phone: +1.2674363713
Tech Phone Ext:
Tech Fax: NONE
Tech Fax Ext:
Tech Email: RAVENHAWKS@RAVENHAWKS.NET
Name Server: ns1.lunarpages.com
Name Server: ns2.lunarpages.com
DNSSEC: unSigned
Registrar Abuse Contact Email: abuse@enom.com
Registrar Abuse Contact Phone: +1.4252982646
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
Last update of WHOIS database:

The data in this whois database is provided to you for information
purposes only, that is, to assist you in obtaining information about or
related to a domain name registration record. We make this information
available "as is," and do not guarantee its accuracy. By submitting a
whois query, you agree that you will use this data only for lawful
purposes and that, under no circumstances will you use this data to: (1)
enable high volume, automated, electronic processes that stress or load
this whois database system providing you this information; or (2) allow,
enable, or otherwise support the transmission of mass unsolicited,
commercial advertising or solicitations via direct mail, electronic
mail, or by telephone. The compilation, repackaging, dissemination or
other use of this data is expressly prohibited without prior written
consent from us.

We reserve the right to modify these terms at any time. By submitting
this query, you agree to abide by these terms.
Version 6.3 4/3/2002

Get Noticed on the Internet! Increase visibility for this domain name by listing it at www.whoisbusinesslistings.com